PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G164700.1
Common NamePHAVU_004G164700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family CPP
Protein Properties Length: 561aa    MW: 60178 Da    PI: 7.3457
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G164700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.91.1e-1492131242
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                         ++k+CnCk+skClk+YCeCfa+g +C+  C+C +C+N+ e+
  Phvul.004G164700.1  92 KQKQCNCKHSKCLKLYCECFASGIYCDG-CNCVNCFNNVEN 131
                         89**************************.********9875 PP

2TCR512.9e-16176215140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Phvul.004G164700.1 176 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 215
                         589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.2E-1791131IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.94692216IPR005172CRC domain
PfamPF036382.8E-1193128IPR005172CRC domain
SMARTSM011148.4E-20176217IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-12179214IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
MGEGEGAGCA PKNALSSEVV APAVVSTAAL EVPARKLARQ LDFTGAPEHP QQQPVAVLPL  60
PPQAPHARVG KPESPKSRSR PNFEMKDATP KKQKQCNCKH SKCLKLYCEC FASGIYCDGC  120
NCVNCFNNVE NEAARREAVE ATLERNPNAF RPKIASSPHG TRDSREEAGD VLILGKHNKG  180
CHCKKSGCLK KYCECFQANI LCSENCKCMD CKNFEGSEER QALFHGDQNN MAYIQQAANA  240
AITGAIGSSG YSSPPVSKKR KGQELFFWPT TKDPSISKLG QQVNHVRGPA PSSSLSPISG  300
ARVGTATLGP SKFMYRSLLA DIIQPQHLKE LCSVLVLVSG QAAKTLTDQK ILMEKHAEDQ  360
TETSLASSSQ EPLPPNQMEG HVEKTVADDC SSANQTDKIS PDDSSSDGAD VPKGRPMSPG  420
TLALMCDEQD TMFMTAASPI GPMAHACNTS SQFPYGQGMT EVYAEQERIV LTKFRDFLNR  480
VITMGEINET KCSSLARNEL ENQKDPIING VGNASSRQHG ASSNGVTKPA ASPLATTSTS  540
MIPANISENG ESKVKIEKDI *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007152845.10.0hypothetical protein PHAVU_004G164700g
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLV7C3Y50.0V7C3Y5_PHAVU; Uncharacterized protein
STRINGGLYMA07G09380.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26263379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-176Tesmin/TSO1-like CXC domain-containing protein